OLIG1 (Oligodendrocyte Transcription Factor 1, Oligo1, Class B Basic Helix-loop-helix Protein 6, bHLHb6, Class E Basic Helix-loop-helix Protein 21, bHLHe21, BHLHB6, BHLHE21)

Größe

£685.00

SKU:: 130709
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa80-159 from human OLIG1 (NP_620450.1) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Olig1 and Olig2, which have been implicated in oligodendrogenesis, are expressed in the region of the ventral ventricular zone of late embryonic spinal cord where oligodendrocyte progenitors appear. Olig3 is transiently expressed in different types of progenitors of embryonic central nervous system and then disappears in the course of development. In adult, expression of Olig3 is primarily detected in neural tissues. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.