NUP43 (Nucleoporin Nup43, Nup107-160 Subcomplex Subunit Nup43, p42, FLJ13287, bA350J20.1, p42)

Größe

£685.00

SKU:: 130649
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa281-381 from human NUP43 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NUP43 probably mediates the assembly of subdomains of the nuclear pore complex (NPC) or facilitates the interaction of transport complexes with the NPC. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.