NUMA1 (Nuclear Mitotic Apparatus Protein 1, NuMA Protein, SP-H Antigen, NUMA)

Größe

£685.00

SKU:: 130645
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa200-307 from human NUMA1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: NuMA (nuclear mitotic apparatus) is a long coil-coiled protein that plays a role in the interphase and mitosis phases of a cell cycle. In interphase, it has been hypothesized to play a structural role in the nucleoskeleton that may be important in nuclear organization and functions. During mitosis, it is associated with spindle microtubule organization and chromosome positioning. Therefore, this antibody is useful as a cell cycle marker. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.