NUBP1 (NBP, NBP1, Cytosolic Fe-S Cluster Assembly Factor NUBP1, Nucleotide-binding Protein 1, MGC117406, MGC130052, MGC130053)

Größe

£685.00

SKU:: 130607
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa222-320 from human NUBP1 (NP_002475) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).[supplied by OMIM]. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.