NTNG2 (Netrin-G2, Laminet-2, KIAA1857, LMNT2, UNQ9381/PRO34206, MGC21884)

Größe

£685.00

SKU:: 130599
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa21-120 from human NTNG2 (NP_115925) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Promotes neurite outgrowth of both axons and dendrites. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGITCGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.