NT5M (5'(3')-deoxyribonucleotidase, Mitochondrial, 5',3'-nucleotidase, Mitochondrial, Deoxy-5'-nucleotidase 2, dNT-2, DNT2, mdN)

Größe

£685.00

SKU:: 130596
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa129-228 from human NT5M (AAH35838) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Dephosphorylates specifically the 5' and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides, and so protects mitochondrial DNA replication from excess dTTP. Has only marginal activity towards dIMP and dGMP. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.