130494
NPC2 (Epididymal Secretory Protein E1, Human Epididymis-specific Protein 1, He1, Niemann-Pick Disease Type C2 Protein, HE1)
Größe
£685.00
- SKU:
- 130494
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-151 from human NPC2 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4B9
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- May be involved in the regulation of the lipid composition of sperm membranes during the maturation in the epididymis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice