NPAS2 (Neuronal PAS Domain-containing Protein 2, Neuronal PAS2, Basic-helix-loop-helix-PAS Protein MOP4, Class E Basic Helix-loop-helix Protein 9, bHLHe9 Member of PAS Protein 4 PAS Domain-containing Protein 4, BHLHE9, MOP4, PASD4)

Größe

£685.00

SKU:: 130489
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa646-739 from human NPAS2 (NP_002509) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: BMAL1-NPAS2 heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins of the circadian clock. This transcription is inhibited in a feedback loop by PER, and also by CRY proteins. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.