130479
NOTCH3 (Neurogenic Locus Notch Homolog Protein 3, Notch 3, Notch 3 Extracellular Truncation, Notch 3 Intracellular Domain)
Größe
£685.00
- SKU:
- 130479
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa47-157 from human NOTCH3 (NP_000426) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1G5
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- The Notch protein sits like a trigger penetrating the cell membrane, with part of it inside and part outside. Proteins when binding to the exterior part cause the release of a portion of the interior part, which typically then makes its way to the cell nucleus to alter gene expression. The Notch gene belongs to a family of epidermal growth factor (EGF)-like homeotic genes, which encode transmembrane proteins with a variable number of cysteine rich EGF like repeats in the extracellular region. Four notch genes have been described in mammals: Notch1,Notch2, Notch3 and Notch4(Int3), which have been implicated in the differentiation of the nervous system and other structures. The EG- like proteins Delta and Serrate have been identified as ligands of Notch1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice