NOLC1 (KIAA0035, Nucleolar and Coiled-Body Phosphoprotein 1, Nucleolar Phosphoprotein p130, Nucleolar 130kD Protein, 140kD Nucleolar Phosphoprotein, Nopp140, Hepatitis C Virus NS5A-Transactivated Protein 13, HCV NS5A-Transactivated Protein 13, NS5ATP13)

Größe

£685.00

SKU:: 130466
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa590-699, from NOLC1 (NP_004732) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6B4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Related to nucleologenesis, may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. May play an important role in transcription catalyzed by RNA polymerase I. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.