NME6 (Nucleoside Diphosphate Kinase 6, NDP Kinase 6, NDK 6, Inhibitor of p53-induced Apoptosis-alpha, IPIA-alpha, nm23-H6)

Größe

£685.00

SKU:: 130431
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-194 from NME6 (AAH01808) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NME6 plays a major role in the synthesis of nucleoside triphosphates other than ATP. It is an inhibitor of p53-induced apoptosis. NME6 is expressed at a moderately low level in many tissues, most abundantly in kidney, prostate, ovary, intestine, and spleen. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.