NME6 (Nucleoside Diphosphate Kinase 6, NDP Kinase 6, NDK 6, Inhibitor of p53-induced Apoptosis-alpha, IPIA-alpha, nm23-H6)

Größe

£685.00

SKU:: 130430
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length human NME6, aa1-194 (NP_005784.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NME6 plays a major role in the synthesis of nucleoside triphosphates other than ATP. It is an inhibitor of p53-induced apoptosis. NME6 is expressed at a moderately low level in many tissues, most abundantly in kidney, prostate, ovary, intestine, and spleen. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.