NME4 (NDPKD, NDPK-D, NM23D, NM23H4, nm23-H4, Nucleoside Diphosphate Kinase D, Nucleoside Diphosphate Kinase Mitochondrial, NDP Kinase Mitochondrial, NDK)

Größe

£685.00

SKU:: 130425
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human NME4, aa1-187 (NP_005000.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NME4, also known as nucleoside diphosphate kinase, mitochondrial, belongs to the NDK family. NME4 are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4. NME4 plays a major role in the synthesis of nucleoside triphosphates other than ATP. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.