130392
NKp46 (Natural Cytotoxicity Triggering Receptor 1, Lymphocyte Antigen 94 Homolog, NK Cell-activating Receptor, Natural Killer Cell p46-related Protein, NK-p46, hNKp46, CD335, NCR1, LY94)
Größe
£685.00
- SKU:
- 130392
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human NCR1, aa1-304 (NP_004820.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CD335, also known as NKp46, is a member of the natural cytotoxicity receptor (NCR) family which trigger cytotoxicity in NK cells. CD335 is directly involved in target cell recognition and lysis and is exclusively expressed on CD3–CD56+ NK cells, suggesting it to be a universal marker for NK cells. NKp46 along with NKp30 and NKp44 are referred to as natural cytoxicity receptors (NCR) and play a very important role in killing virus-infected, tumor cells and MHC-class I-unprotected cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice