NIFUN (Iron-Sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, NifU-like N-Terminal Domain-Containing Protein, NifU-like Protein, ISCU)

Größe

£685.00

SKU:: 130373
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa26-167 from NIFUN (AAH11906) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B8-1C4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Involved in the assembly or repair of the [Fe-S] clusters present in iron-sulfur proteins. Binds iron. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.