NID1 (Nidogen 1, NID, NID-1, Nidogen-1, Entactin)

Größe

£685.00

SKU:: 130370
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1148-1248 from human NID1 (NP_002499) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Nidogen-1 is a member of the nidogen family of basement membrane glycoproteins. It interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix . Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.