NHLH2 (BHLHA34, HEN2, KIAA0490, Helix-loop-helix Protein 2, Class A Basic Helix-loop-helix Protein 34, Nescient Helix Loop Helix 2)

Größe

£685.00

SKU:: 130360
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant corresponding to aa36-135 from human NHLH2 (NP_005590) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NHLH2 may serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.