NGFRAP1 (Protein BEX3, Brain-expressed X-linked Protein 3, Nerve Growth Factor Receptor-associated Protein 1, Ovarian Granulosa Cell 13.0kD Protein HGR74, p75NTR-associated Cell Death Executor, BEX3, DXS6984E, NADE)

Größe

£685.00

SKU:: 130354
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-110 from human NGFRAP1 (AAH03190) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4E5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death. May play an important role in the pathogenesis of neurogenetic diseases. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.