NGFRAP1 (Protein BEX3, Brain-expressed X-linked Protein 3, Nerve Growth Factor Receptor-associated Protein 1, Ovarian Granulosa Cell 13.0kD Protein HGR74, p75NTR-associated Cell Death Executor, BEX3, DXS6984E, NADE)

Größe

£685.00

SKU:: 130353
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human NGFRAP1, aa1-101 (NP_996800.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death. May play an important role in the pathogenesis of neurogenetic diseases. Applications: Suitable for use in Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.