NFRKB (Nuclear Factor Related to kappa-B-binding Protein, DNA-binding Protein R kappa-B, INO80 Complex Subunit G, INO80G, DKFZp547B2013)

Größe

£685.00

SKU:: 130344
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa90-198 from human NFRKB (NP_006156) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G8
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Binds to the DNA consensus sequence 5'-GGGGAATCTCC-3'. Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. Modulates the deubiquitinase activity of UCHL5 in the INO80 complex. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FPEDSAEQQNELILALFSGENFRFGNPLHIAQKLFRDGHFNPEVVKYRQLCFKSQYKRYLNSQQQYFHRLLKQILASRSDLLEMARRSGPALPFRQKRPSPSRTPEER Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.