NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4)

Größe

£685.00

SKU:: 130327
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa70-150 from human NFATC3 (NP_775188) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3A12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NFATC3 is a 145-150kD member of the NFAT family of transcription factors. NFATC3 is widely expressed being found in DP thymocytes, CD4+ T cells, smooth muscle cells, Schwann cells and mast cells. NFATC3 regulates gene transcription as part of a NFATC transcription complex. It is normally cytoplasmic and phosphorylated. Upon a rise in intracellular Ca+2, dephosphorylation occurs via calcineurin, and NFATC3 enters the nucleus. Human NFATC3 is 1075aa in length. It contains a calcineurin binding site aa109-114, two NLSs aa273-275, 686-688, one NES aa1032-1041 and an RHD that binds DNA aa433-592. There are multiple isoforms. Thirty aa, 33aa and 10aa substitutions for aa1036-1075 are known that may be accompanied by an alternate start site at aa480. Over aa900-1035, human NFATC3 shares 93aa identity with mouse NFATC3. Applications: Suitable for use in Immunofluorescence, ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice