130327-ML490
NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (MaxLight 490)
Größe
£914.00
- SKU:
- 130327-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa70-150 from human NFATC3 (NP_775188) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. NFATC3 is a 145-150kD member of the NFAT family of transcription factors. NFATC3 is widely expressed being found in DP thymocytes, CD4+ T cells, smooth muscle cells, Schwann cells and mast cells. NFATC3 regulates gene transcription as part of a NFATC transcription complex. It is normally cytoplasmic and phosphorylated. Upon a rise in intracellular Ca+2, dephosphorylation occurs via calcineurin, and NFATC3 enters the nucleus. Human NFATC3 is 1075aa in length. It contains a calcineurin binding site aa109-114, two NLSs aa273-275, 686-688, one NES aa1032-1041 and an RHD that binds DNA aa433-592. There are multiple isoforms. Thirty aa, 33aa and 10aa substitutions for aa1036-1075 are known that may be accompanied by an alternate start site at aa480. Over aa900-1035, human NFATC3 shares 93aa identity with mouse NFATC3. Applications: Suitable for use in Immunofluorescence, FLISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice