130327-BIOTIN
NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (Biotin)
Größe
£914.00
- SKU:
- 130327-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa70-150 from human NFATC3 (NP_775188) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- NFATC3 is a 145-150kD member of the NFAT family of transcription factors. NFATC3 is widely expressed being found in DP thymocytes, CD4+ T cells, smooth muscle cells, Schwann cells and mast cells. NFATC3 regulates gene transcription as part of a NFATC transcription complex. It is normally cytoplasmic and phosphorylated. Upon a rise in intracellular Ca+2, dephosphorylation occurs via calcineurin, and NFATC3 enters the nucleus. Human NFATC3 is 1075aa in length. It contains a calcineurin binding site aa109-114, two NLSs aa273-275, 686-688, one NES aa1032-1041 and an RHD that binds DNA aa433-592. There are multiple isoforms. Thirty aa, 33aa and 10aa substitutions for aa1036-1075 are known that may be accompanied by an alternate start site at aa480. Over aa900-1035, human NFATC3 shares 93aa identity with mouse NFATC3. Applications: Suitable for use in Immunofluorescence, ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice