130318-HRP
Neuroligin 1 (Neuroligin-1, NLGN1, KIAA1070) (HRP)
Größe
£914.00
- SKU:
- 130318-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa578-678 from human Neuroligin 1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).
- Weitere Details:
- Neuroligin-1 is a neuronal cell surface protein belonging to the type-B carboxylesterase/lipase family. It is a necessary component in the maturation of excitatory synapses for their normal, functional development, and is necessary to the regulation of synaptic plasticity and the development of long-term memory within the adult amygdala in mammals. It is believed to participate in cell-cell-interaction through the assembly of intracellular junction by the binding of beta-neurexins, and may also be a factor in the maintenance and assembly of synaptic junctions. It is also thought to have involvement in excitatory synaptic specification. Within brain tissue, Neuroligin-1 is primarily observed in neurons and spinal cord. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice