130308-BIOTIN
Neurofibromin (NF1, WSS, NFNS, VRNF, NF, Neurofibromin 1, Neurofibromatosis, Type I, von Recklinghausen Disease Neurofibromin, Neurofibromatosis-Noonan Syndrome, WATS, Watson Syndrome) (Biotin)
Größe
£914.00
- SKU:
- 130308-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2719-2818 from human NF1 (NP_000258) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- NF1 contains a GTPase-activating protein-related domain (GRD), and is involved in the negative regulation of Ras proteins, by accelerating the hydrolysis of active Ras-guanosine triphosphate. Mutations of NF1 have been reported in Neurofibromatosis type 1, which is characterized by a predisposition to a variety of tumors of the peripheral and central nervous systems as well as myeloid leukemia, cognitive deficits, bone deformations, and pigmentation defects. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice