NEUROD6 (Neurogenic Differentiation Factor 6, NeuroD6, Class A Basic Helix-loop-helix Protein 2, bHLHa2, Protein Atonal Homolog 2, ATOH2, BHLHA2, My051, MATH2, NEX1M)

Größe

£685.00

SKU:: 130307
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa191-290 from human NEUROD6 (NP_073565) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.