130307-APC

NEUROD6 (Neurogenic Differentiation Factor 6, NeuroD6, Class A Basic Helix-loop-helix Protein 2, bHLHa2, Protein Atonal Homolog 2, ATOH2, BHLHA2, My051, MATH2, NEX1M) (APC)

Größe

£927.00

SKU:: 130307-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa191-290 from human NEUROD6 (NP_073565) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B3
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.