130305
NEUROD2 (Neurogenic Differentiation Factor 2, NeuroD2, Class A Basic Helix-loop-helix Protein 1, bHLHa1, NeuroD-related Factor, NDRF, BHLHA1, NDRF)
Größe
£685.00
- SKU:
- 130305
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa266-375 from human NEUROD2 (NP_006151) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3E7
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- NeuroD2 is a 41kD nuclear member of the neuroD family of transcription factors. It is expressed in developing and mature neurons such as hippocampal granular neurons, and acts (in part) to repress factors that would otherwise block multipotential cell commitment to a neuronal lineage. NeuroD2 is presumed to act as a heterodimer with other bHLH transcription factors. Human NeuroD2 is 382aa in length. It contains a poly-Glu region aa82-91, an NLS aa107-113, a DNA-binding HLH domain aa119-178 and a poly-Gly segment aa282-285. Based on rat studies, human NeuroD2 will undergo variable phosphorylation in the C-terminal region. Over aa174-382, human and mouse NeuroD2 possess identical aa sequences. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice