130291-BIOTIN

NENF (Neudesin, Cell Immortalization-related Protein 2, Neuron-derived Neurotrophic Factor, Secreted Protein of Unknown Function, SPUF Protein, CIR2, SPUF) (Biotin)

Größe

£914.00

SKU:: 130291-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-172 from human NENF (NP_037481) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7D10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: NENF is a secreted protein that is expressed in neurons but not glial cells of the brain. This protein has neurotrophic activity in primary cultured mouse neurons but not mitogenic activity in primary cultured mouse astrocytes. NENF activated mitogen-activated protein (MAP) and phosphotidylinositol-3 kinase pathways and could be inhibited by pertussis toxin but not receptor tyrosine kinases, suggesting that NENF acts through a Gi/Go-protein-coupled receptor. Despite its predicted molecular weight of ~20kD, NENF is observed at 37kD in SDS-PAGE. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice