NELL2 (Protein Kinase C-binding Protein NELL2, MEL91 Protein, NEL-like Protein 2, Mel91)

Größe

£685.00

SKU:: 130290
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa301-400 from human NELL2 (NP_006150) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Protein kinase C-binding protein, NELL2 is expressed abundantly in neural tissues and may play important roles in the development of neural tissues. Also, NELL protein contains six epidermal growth factor (EGF)-like repeat domains that participate in calcium binding. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.