130289-FITC
NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (FITC)
Größe
£914.00
- SKU:
- 130289-FITC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa304-403 from human NELL1 (NP_006148) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 6A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- NELL1 (neural EGF-like like protein 1) is an 89kD (predicted) member of the EGF-like domain containing family, Laminin G/NTSP1/Pentraxin gene superfamily of molecules. When secreted, NELL1 exists as a phosphoglycoprotein that can add as much as 50kD to the calculated MW. NELL1 has restricted expression, being limited to pre-B cells and osteoblasts, where it apparently promotes osteoblast maturation and bone formation. In tumors, it is found in neuroblastoma- derived cells. NELL1 is both secreted and retained intracellularly where it is phosphorylated by PKC. The human NELL1 precursor is 810aa in length. It contains a16aa signal sequence plus a 794aa mature region. The mature region possesses an N-terminal TSP domain (aa81-230), two VWFC domains (aa271-390), six consecutive EGF-like domains (aa391-631), and three additional C-terminal VWFC domains (aa632 807). Secreted NELL1 forms a 400-420kD noncovalent homotrimer. Over aa17-810, human NELL1 shares 93% aa identity with mouse and rat NELL1. Alternate splicing generates an additional isoform of human NELL1 hat lacks the fifth EGF-like domain. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice