NEIL2 (Endonuclease 8-like 2, DNA Glycosylase/AP Lyase Neil2, DNA-(apurinic or apyrimidinic site) Lyase Neil2, Endonuclease VIII-like 2, Nei Homolog 2, Nei-like Protein 2, FLJ31644, MGC2832, MGC4505, NEH2, NEI2)

Größe

£685.00

SKU:: 130268
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-333 from human NEIL2 (AAH13964) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit for recombinant GST tagged NEIL2 is ~1ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice