NDUFV1 (NADH Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial, NADH-Ubiquinone Oxidoreductase 51kD Subunit, Complex I-51kD, CI-51kD, NADH Dehydrogenase Flavoprotein 1, UQOR1)

Größe

£685.00

SKU:: 130247
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa365-464 from human NDUFV1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4A7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The NDUFV1 gene encodes the 51kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain. [supplied by OMIM] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.