NDRG2 (Protein NDRG2, N-myc Downstream-regulated Gene 2 Protein, Protein Syld709613, KIAA1248, SYLD, DKFZp781G1938, FLJ25522)

Größe

£685.00

SKU:: 130199
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-97 from human NDRG2 (NP_057334) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6A5
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: NDRG2 (NDRG family member 2) belongs to the N-myc downregulated gene family. It is a cytoplasmic protein which may be involved in dendritic cell and neuron differentiation. It is upregulated at both the RNA and protein levels in Alzheimer's disease. NDRG2 mRNA is downregulated or undetectable in several human cancers and cancer cell-lines, suggesting that it may have anti-tumor activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.