130197-ML550
NDRG1 (Protein NDRG1, Differentiation-related Gene 1 Protein, DRG-1, N-myc Downstream-regulated Gene 1 Protein, Nickel-specific Induction Protein Cap43, Reducing Agents and Tunicamycin-responsive Protein, RTP, Rit42, CAP43, DRG1) (MaxLight 550)
Größe
£914.00
- SKU:
- 130197-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-394 from NDRG1 (AAH03175) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. NDRG1 is a member of the emerging NDRG family involved in stress responses, hormone responses, cell growth, and differentiation. The NDRG1 gene is mapped to human chromosome 8q24.2 and encodes a cytosolic protein containing three unique tandem repeats of 10 hydrophilic amino acids near the C-terminus. Expression of NDRG1 is markedly upregulated in various cells under such conditions as cell differentiation, hypoxia and exposure to heavy metals. However, its expression is repressed by the Myc family transcription factors and after cellular transformation. Mutations in the NDRG1 gene are linked to the hereditary motor and sensory neuropathy. The protein is ubiquitously expressed in human and rat heart, brain, kidney, placenta, lung, liver, skeletal muscle, and pancreas. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.7ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice