NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3 Adapter Protein SPIN90, WASP-interacting SH3-domain Protein, WISH, Wiskott-Aldrich Syndrome Protein-interacting Protein, SPIN90, MGC23891)

Größe

£685.00

SKU:: 130180
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human NCKIPSD (NP_909119) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: SPIN90 is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.