130180-BIOTIN

NCKIPSD (NCK Interacting Protein with SH3 Domain, AF3P21, 54kD VacA-interacting Protein, 54kD Vimentin-interacting Protein, VIP54, 90kD SH3 Protein Interacting with Nck, AF3p21, Dia-interacting Protein 1, DIP-1, Diaphanous Protein-interacting Protein, SH3 Adapter Protein SPIN90, WASP-interacting SH3-domain Protein, WISH, Wiskott-Aldrich Syndrome Protein-interacting Protein, SPIN90, MGC23891) (Biotin)

Größe

£914.00

SKU:: 130180-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human NCKIPSD (NP_909119) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: SPIN90 is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice