130167-BIOTIN
NBR1 (Next To BRCA1 Gene 1 Protein, Neighbor Of BRCA1 Gene 1 Protein, Membrane Component Chromosome 17 Surface Marker 2, Protein 1A1-3B, Cell Migration-Inducing Gene 19 Protein, 1A13B, KIAA0049, M17S2, MIG19) (Biotin)
Größe
£914.00
- SKU:
- 130167-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa2-96 from human NBR1 (NP_005890) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 5C3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Next to BRCA1 gene 1 (NBR1) protein is known for its encoding gene proximity to the BRCA1 tumor suppressor gene. N-terminal Phox and Bem1p (PB1) domains of NBR1 mediate its interaction with muscle specific tintin kinase and scaffolding protein p62. NBR1 plays a role in autophagy by facilitating the autophagosomal degradation of ubiquitinated proteins independently and also in concert with p62. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice