130164-BIOTIN
NBL1 (Neuroblastoma Suppressor Of Tumorigenicity 1, Zinc Finger Protein DAN, Protein N03, DAN Domain Family Member 1, DAN, DAND1) (Biotin)
Größe
£914.00
- SKU:
- 130164-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa21-130 from human NBL1 (NP_005371) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- NBL1 is a transcription factor that may function as an inhibitor or repressor in cell growth and/or maintenance, and plays a role in the negative regulation of the cell cycle. It has a possible tumor suppressive activity when over expressed. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice