NAV2 (Neuron Navigator 2, Helicase APC Down-regulated 1, Pore Membrane and/or Filament-interacting-like Protein 2, Retinoic Acid Inducible in Neuroblastoma 1, Steerin-2, Unc-53 Homolog 2, unc53H2, HELAD1, KIAA1419, POMFIL2, RAINB1, STEERIN2, FLJ10633, FLJ11030, FLJ23707, FLJ77876)

Größe

£685.00

SKU:: 130163
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1878-1973 from human NAV2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Possesses 3' to 5' helicase activity and exonuclease activity. Involved in neuronal development, specifically in the development of different sensory organs. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.