NARF (Nuclear Prelamin A Recognition Factor, Iron-only Hydrogenase-like Protein 2, IOP2)

Größe

£698.00

SKU:: 130148
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human NARF with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7D9
Format:: Supplied as a liquid in ascites fluid.
Weitere Details:: Interacts with LMNA and binds to the farnesylated C-terminal domain. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKCEHCTRKECSKKTKTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.