NANP (N-Acetylneuraminic Acid Phosphatase, N-Acylneuraminate-9-Phosphatase, C20orf147, dJ694B14.3, Haloacid Dehalogenase-like Hydrolase Domain-containing Protein 4, HDHD4, MGC26833, Neu5Ac-9-Pase)

Größe

£685.00

SKU:: 130132
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human NANP, aa1-248 (NP_689880.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May belong in the haloacid dehalogenase family of phosphatases. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.