130129-BIOTIN

NANOG (Homeobox Protein NANOG, Homeobox Transcription Factor Nanog, hNanog, FLJ12581, FLJ40451) (Biotin)

Größe

£914.00

SKU:: 130129-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa98-196 from human NANOG (NP_079141) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: NANOG is a unique variant of NK2 family of transcription factors. It is a human ortholog of mouse Nanog and consists of a highly conserved homeodomain and Trp-rich repeats. It is specifically expressed by embryonic stem cells and is crucial for second embryonic lineage determination. It works in concert with OCT-4 and SOX-2 and plays a central role in regulating pluripotency and self-renewal of ICM and ES cells. It functions independent of LIF:gp130:Stat3 pathway and prevents differentiation of ES cells to extraembryonic endoderm and trophectoderm lineages. Its expression has also been detected in embryonic carcinoma cells and germ line tumors indicating a therapeutic intervention. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice