130109
N4BP2 (NEDD4-binding Protein 2, N4BP2, BCL-3-binding Protein, B3BP, KIAA1413, FLJ10680)
Größe
£685.00
- SKU:
- 130109
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1671-1771 from human N4BP2 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2H5
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Has 5'-polynucleotide kinase and nicking endonuclease activity. May play a role in DNA repair or recombination. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice