MZF1 (Myeloid Zinc Finger 1, MZF-1, Zinc Finger and SCAN Domain-containing Protein 6, Zinc Finger Protein 42, MZF, ZNF42, ZSCAN6)

Größe

£685.00

SKU:: 130107
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa419-519 of human MZF1 (NP_003413) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Binds to target promoter DNA and functions as trancription regulator. Regulates transcription from the PADI1 and CDH2 promoter. May be one regulator of transcriptional events during hemopoietic development. Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVEC* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.