MZB1 (Marginal Zone B- and B1-cell-specific Protein, Mesenteric Estrogen-dependent Adipose 7, MEDA-7, Plasma Cell-induced Resident Endoplasmic Reticulum Protein, Plasma Cell-induced Resident ER Protein, pERp1, Proapoptotic Caspase Adapter Protein, MEDA7, PACAP, HSPC190, FLJ32987, MGC29506)

Größe

£685.00

SKU:: 130106
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human PACAP, aa1-190 (AAH21275).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca2+ stores, antibody secretion and integrin activation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.