MYOZ2 (Myozenin 2, Myozenin-2, Calsarcin-1, FATZ-related Protein 2, C4orf5)

Größe

£685.00

SKU:: 130096
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-265 from human MYOZ2 (AAH05195) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as ACTN2, FLNC, TCAP and localizing calcineurin signaling to the sarcomere. It may play a role in myofibrillogenesis. It is expressed specifically in heart and skeletal muscle. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKRVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.