Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8)

Größe

£685.00

SKU:: 130091
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa243-310 from human GDF8 (NP_005250) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: GDF-8, also known as Myostatin, belongs to the TGF-beta superfamily. It is synthesized as an inactive proprotein with the N-terminal pro-region and the C-terminal mature bioactive region. The GDF-8 proregion is capable of associating with active GDF-8 with high affinity and is a potent GDF-8 antagonist. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.