MYL9 (Myosin Regulatory Light Polypeptide 9, 20kD Myosin Light Chain, LC20, MLC-2C, Myosin RLC, Myosin Regulatory Light Chain 2, Smooth Muscle Isoform, Myosin Regulatory Light Chain 9, Myosin Regulatory Light Chain MRLC1, MLC2, MRLC1, MYRL2, MGC3505)

Größe

£685.00

SKU:: 130062
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-118 from MYL9 (AAH02648) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.