MYL2 (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform, MLC-2, MLC-2v, DKFZp779C0562)

Größe

£685.00

SKU:: 130053
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-166 from human MYL2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3B9-B4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: MYL2 encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in MYL2 are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.